- DNAH14 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88327
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Human
- Unconjugated
- DNAH14
- C1orf67, Dnahc14, HL-18, HL18
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: FIIPSIDDIS AQLEESQVIL ATIKGSPHIG PIKDLVNEWD QNLTLFSYTL EEWMNCQRNW LYLEPVFHSS EIRR
- dynein axonemal heavy chain 14
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRR
Specifications/Features
Available conjugates: Unconjugated